PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011082026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 442aa    MW: 48303.9 Da    PI: 4.4517
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011082026.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.92.3e-17450349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    ie++   + tfskRr g+ KKA+ELS+LC++++ +iifs+t++ y +
  XP_011082026.1  4 IESQDDLYATFSKRRLGLYKKASELSTLCGVDIGIIIFSPTNNPYSF 50
                    888999999********************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-16153IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.98E-21165IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.6154IPR002100Transcription factor, MADS-box
PfamPF003198.6E-21450IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-81631IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-83152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MRLIESQDDL YATFSKRRLG LYKKASELST LCGVDIGIII FSPTNNPYSF FHPSMESVIE  60
RYRNPDQPPN DLARIVEGHT RTRIEQLNKR LDEILDMKEQ IKEREKYLDE VDKTRPRGWW  120
EQPIESLNAQ QVQEWKEWFG NFHAQVTSRI EELTNGGSGS LENAPIFPDP PSSSTTAVPS  180
MFPPNYVPPA DTSSALGDGI AEVDQFSGQY YYAPPQGQDP FVVGSNQFYD PPQCQGPNSG  240
TNQYLSLSEA PNPSGTGSSQ YYGPPSIQNP SGAGPSLYYG PPSVQNPSGP GPSQYYGLPL  300
SQNPPAAGSN KYYEPPQAQD PSGTGPNQYY GPPLAPTPSV FGLSQFYGLQ QGQDPSNIGP  360
NQFNVPLSTK NPSGVGPNQF YGPPPGQDPF GIGPSQFYRP PLGQDSSGIR PRRFYNAQQG  420
RDPSATGGTK EAGTSNQEDS DL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082025.10.0PREDICTED: proline-rich extensin-like protein EPR1 isoform X1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.19e-30AGAMOUS-like 61